PDB entry 1fbu

View 1fbu on RCSB PDB site
Description: heat shock transcription factor DNA binding domain
Class: transcription
Keywords: helical bulge, helical kink, helix-turn-helix, TRANSCRIPTION
Deposited on 2000-07-16, released 2001-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock factor protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22121 (0-86)
      • cloning artifact (87-88)
    Domains in SCOPe 2.08: d1fbua1, d1fbua2
  • Chain 'B':
    Compound: heat shock factor protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22121 (0-86)
      • cloning artifact (87-89)
    Domains in SCOPe 2.08: d1fbub1, d1fbub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fbuA (A:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha

    Sequence, based on observed residues (ATOM records): (download) 
    >1fbuA (A:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fbuB (B:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha