PDB entry 1fbs

View 1fbs on RCSB PDB site
Description: heat shock transcription factor DNA binding domain containing the p237a mutation
Class: transcription
Keywords: helical bulge, helical kink, helix-turn-helix, TRANSCRIPTION
Deposited on 2000-07-16, released 2001-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock factor protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22121 (0-86)
      • engineered (42)
      • cloning artifact (87)
    Domains in SCOPe 2.08: d1fbsa1, d1fbsa2
  • Chain 'B':
    Compound: heat shock factor protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22121 (0-86)
      • engineered (42)
      • cloning artifact (87-89)
    Domains in SCOPe 2.08: d1fbsb1, d1fbsb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fbsA (A:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha

    Sequence, based on observed residues (ATOM records): (download) 
    >1fbsA (A:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefener

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fbsB (B:)
pafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlakyfkhsnfasfvrqlnm
ygwhkvqdvksgsmlsnndsrwefenerha