PDB entry 1fbr

View 1fbr on RCSB PDB site
Description: fourth and fifth fibronectin type I module pair
Class: cell adhesion protein
Keywords: cell adhesion protein
Deposited on 1995-08-08, released 1995-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN FIBRONECTIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fbra1, d1fbra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbrA (A:)
    aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsrnrcndqdtrtsyri
    gdtwskkdnrgnllqcictgngrgewkcerhts