PDB entry 1fbm

View 1fbm on RCSB PDB site
Description: assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Class: cell adhesion
Keywords: extracellular matrix protein, assembly domain, cartilage, oligomeric matrix protein, glycoprotein, retinol-complex, cell adhesion
Deposited on 2000-07-16, released 2000-08-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cartilage oligomeric matrix protein)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (0-45)
    • conflict (0)
    • conflict (26-27)
  Domains in SCOPe 2.03: d1fbma_
• Chain 'B':
  Compound: protein (cartilage oligomeric matrix protein)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (0-45)
    • conflict (0)
    • conflict (26-27)
  Domains in SCOPe 2.03: d1fbmb_
• Chain 'C':
  Compound: protein (cartilage oligomeric matrix protein)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (0-45)
    • conflict (0)
    • conflict (26-27)
  Domains in SCOPe 2.03: d1fbmc_
• Chain 'D':
  Compound: protein (cartilage oligomeric matrix protein)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (0-45)
    • conflict (0)
    • conflict (26-27)
  Domains in SCOPe 2.03: d1fbmd_
• Chain 'E':
  Compound: protein (cartilage oligomeric matrix protein)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35444 (0-45)
    • conflict (0)
    • conflict (26-27)
  Domains in SCOPe 2.03: d1fbme_
• Heterogens: RTL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fbmA (A:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fbmB (B:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fbmC (C:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fbmD (D:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fbmE (E:)
  mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg