PDB entry 1fbm
View 1fbm on RCSB PDB site
Description: assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Class: cell adhesion
Keywords: extracellular matrix protein, assembly domain, cartilage, oligomeric matrix protein, glycoprotein, retinol-complex, cell adhesion
Deposited on
2000-07-16, released
2000-08-02
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (cartilage oligomeric matrix protein)
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P35444 (0-45)
- conflict (0)
- conflict (26-27)
Domains in SCOPe 2.03: d1fbma_ - Chain 'B':
Compound: protein (cartilage oligomeric matrix protein)
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P35444 (0-45)
- conflict (0)
- conflict (26-27)
Domains in SCOPe 2.03: d1fbmb_ - Chain 'C':
Compound: protein (cartilage oligomeric matrix protein)
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P35444 (0-45)
- conflict (0)
- conflict (26-27)
Domains in SCOPe 2.03: d1fbmc_ - Chain 'D':
Compound: protein (cartilage oligomeric matrix protein)
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P35444 (0-45)
- conflict (0)
- conflict (26-27)
Domains in SCOPe 2.03: d1fbmd_ - Chain 'E':
Compound: protein (cartilage oligomeric matrix protein)
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P35444 (0-45)
- conflict (0)
- conflict (26-27)
Domains in SCOPe 2.03: d1fbme_ - Heterogens: RTL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbmA (A:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbmB (B:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbmC (C:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbmD (D:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbmE (E:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg