PDB entry 1fbl

View 1fbl on RCSB PDB site
Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller
Deposited on 1995-04-24, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbl_ (-)
    fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
    lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsgpqtpqvcd
    skltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaayeiadrde
    vrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyffvahecwr
    ydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfktkriltlqk
    answfnc