PDB entry 1fbl

View 1fbl on RCSB PDB site
Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller
Class: metalloprotease
Keywords: metalloprotease
Deposited on 1995-04-24, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast (interstitial) collagenase (mmp-1)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fbla1, d1fbla2
  • Heterogens: CA, ZN, HTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fblA (A:)
    fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
    lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsgpqtpqvcd
    skltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaayeiadrde
    vrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyffvahecwr
    ydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfktkriltlqk
    answfncrkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fblA (A:)
    fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
    lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsgpqtpqvcd
    skltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaayeiadrde
    vrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyffvahecwr
    ydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfktkriltlqk
    answfnc