PDB entry 1fbi

View 1fbi on RCSB PDB site
Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
Class: complex (antibody/antigen)
Keywords: complex (antibody/antigen)
Deposited on 1995-01-19, released 1995-02-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1 f9.13.7 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fbih1, d1fbih2
  • Chain 'L':
    Compound: igg1 f9.13.7 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FBI (0-213)
    Domains in SCOPe 2.03: d1fbil1, d1fbil2
  • Chain 'P':
    Compound: igg1 f9.13.7 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FBI (0-213)
    Domains in SCOPe 2.03: d1fbip1, d1fbip2
  • Chain 'Q':
    Compound: igg1 f9.13.7 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fbiq1, d1fbiq2
  • Chain 'X':
    Compound: guinea fowl lysozyme
    Species: Numida meleagris [TaxId:8996]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fbix_
  • Chain 'Y':
    Compound: guinea fowl lysozyme
    Species: Numida meleagris [TaxId:8996]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fbiy_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqgpgqglewigeidpsdsypny
    nekfkgkatltvdkssstaymqlssltsedsavyycaslyyygtsygvldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqkkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltirnleqediatyfcqqgytlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiP (P:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqkkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltirnleqediatyfcqqgytlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiQ (Q:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqgpgqglewigeidpsdsypny
    nekfkgkatltvdkssstaymqlssltsedsavyycaslyyygtsygvldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiX (X:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
    rvwikgcrl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbiY (Y:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
    rvwikgcrl