PDB entry 1fb9

View 1fb9 on RCSB PDB site
Description: effects of s-sulfonation on the solution structure of salmon calcitonin
Class: signaling protein
Keywords: alpha helix, SIGNALING PROTEIN
Deposited on 2000-07-14, released 2003-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcitonin analogue
  Species: Oncorhynchus gorbuscha [TaxId:8017]
  Database cross-references and differences (RAF-indexed):
  • GB CAA54988 (0-31)
    • modified residue (0)
    • modified residue (6)
  Domains in SCOPe 2.08: d1fb9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fb9A (A:)
  csnlstcvlgklsqelhklqtyprtntgsgtp