PDB entry 1fb5

View 1fb5 on RCSB PDB site
Description: low resolution structure of ovine ornithine transcarbmoylase in the unliganded state
Class: transferase
Keywords: cooperativity, T-state, ornithine, TRANSFERASE
Deposited on 2000-07-14, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.212
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine transcarbamoylase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00480 (0-319)
      • see remark 999 (66)
      • see remark 999 (114)
      • see remark 999 (124)
      • see remark 999 (235)
      • see remark 999 (252)
      • see remark 999 (262)
      • see remark 999 (253)
      • see remark 999 (279)
    Domains in SCOPe 2.07: d1fb5a1, d1fb5a2
  • Heterogens: NVA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb5A (A:)
    vqlkgrdlltlknftgeeikymlwlsadlkfrikqkgeylpllqgkslgmifekrstrtr
    lstetgfallgghpcflttqdihlgvnesltdtarvlssmadavlarvykqsdletlake
    asipvinglsdlyhpiqiladyltlqehysslkgltlswigdgnnilhsimmsaakfgmh
    lqaatpkgyepdasvtklaeqyakengtkllltndpleaahggnvlitdtwismgreeek
    kkrlqafqgyqvnsktakvaasawtflhclprkpeevdddvfysprslvfpeaenrkwti
    mavmvslltdyspqlqkpkf