PDB entry 1fb1

View 1fb1 on RCSB PDB site
Description: crystal structure of human gtp cyclohydrolase i
Deposited on 2000-07-14, released 2000-12-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-08, with a file datestamp of 2000-12-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.204
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fb1a_
  • Chain 'B':
    Domains in SCOP 1.55: d1fb1b_
  • Chain 'C':
    Domains in SCOP 1.55: d1fb1c_
  • Chain 'D':
    Domains in SCOP 1.55: d1fb1d_
  • Chain 'E':
    Domains in SCOP 1.55: d1fb1e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb1A (A:)
    gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
    dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
    ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
    redpktreefltlirs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb1B (B:)
    gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
    dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
    ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
    redpktreefltlirs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb1C (C:)
    gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
    dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
    ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
    redpktreefltlirs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb1D (D:)
    gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
    dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
    ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
    redpktreefltlirs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fb1E (E:)
    gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
    dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
    ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
    redpktreefltlirs