PDB entry 1faz

View 1faz on RCSB PDB site
Description: the crystal structure of prokaryotic phospholipase a2
Class: hydrolase
Keywords: phospholipase A2, prokaryote, Streptomyces violaceoruber
Deposited on 2000-07-14, released 2001-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Streptomyces violaceoruber
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1faza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fazA (A:)
    apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
    carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
    fg