PDB entry 1fay

View 1fay on RCSB PDB site
Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)
Class: sugar binding protein
Keywords: legume lectin, glycosylated protein, h-antigenic specificity, agglutinin, sugar binding protein
Deposited on 2000-07-14, released 2001-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.204
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1faya_
  • Chain 'B':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayb_
  • Chain 'C':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayc_
  • Chain 'D':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayd_
  • Chain 'E':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1faye_
  • Chain 'F':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayf_
  • Chain 'G':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayg_
  • Chain 'H':
    Compound: acidic lectin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • GB CAB57877 (0-End)
      • engineered (27)
      • engineered (100)
      • engineered (119)
    Domains in SCOPe 2.07: d1fayh_
  • Heterogens: AMG, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fayA (A:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayA (A:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fayB (B:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayB (B:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fayC (C:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayC (C:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fayD (D:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayD (D:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fayE (E:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayE (E:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fayF (F:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayF (F:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fayG (G:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayG (G:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1fayH (H:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fayH (H:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe