PDB entry 1fax

View 1fax on RCSB PDB site
Description: coagulation factor xa inhibitor complex
Class: coagulation factor
Keywords: glycoprotein, hydrolase, serine protease, plasma, blood coagulation factor, gamma-carboxyglutamic acid, calcium-binding
Deposited on 1996-08-23, released 1997-10-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.197
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor xa
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00742 (0-End)
      • conflict (59-60)
    Domains in SCOP 1.73: d1faxa_
  • Chain 'L':
    Compound: factor xa
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00742 (Start-95)
      • conflict (61)
    Domains in SCOP 1.73: d1faxl_
  • Heterogens: CA, DX9

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1faxA (A:)
    ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
    aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
    tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
    cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktrglpka
    kshapevitssplk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1faxA (A:)
    ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
    aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
    tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
    cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1faxL (L:)
    ykdgdqcetspcqnqgkckdglgeytctclegfegkncelftrklcsldngdcdqfchee
    qasvvcscargytladngkaciptgpypcgkqtler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1faxL (L:)
    trklcsldngdcdqfcheeqasvvcscargytladngkaciptgpypcgkqtler