PDB entry 1fax

View 1fax on RCSB PDB site
Description: coagulation factor xa inhibitor complex
Deposited on 1996-08-23, released 1997-10-29
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-29, with a file datestamp of 1997-10-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.197
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1faxa_
  • Chain 'L':
    Domains in SCOP 1.55: d1faxl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faxA (A:)
    ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta
    aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
    tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
    cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faxL (L:)
    trklcsldngdcdqfcheeqasvvcscargytladngkaciptgpypcgkqtler