PDB entry 1faw

View 1faw on RCSB PDB site
Description: graylag goose hemoglobin (oxy form)
Deposited on 2000-07-13, released 2001-12-05
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: 0.176
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fawa_
  • Chain 'B':
    Domains in SCOP 1.63: d1fawb_
  • Chain 'C':
    Domains in SCOP 1.63: d1fawc_
  • Chain 'D':
    Domains in SCOP 1.63: d1fawd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fawA (A:)
    vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
    vhasldkflcavgtvltakyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fawB (B:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpecqaawqklvrvvahalarkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fawC (C:)
    vlsaadktnvkgvfskigghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
    kvaaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltpe
    vhasldkflcavgtvltakyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fawD (D:)
    vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
    eftpecqaawqklvrvvahalarkyh