PDB entry 1fav

View 1fav on RCSB PDB site
Description: the structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Deposited on 2000-07-13, released 2000-08-23
The last revision was dated 2021-11-03, with a file datestamp of 2021-10-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.24
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope protein chimera
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: GCN4,AAS3,ARG9,YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-28)
      • engineered mutation (1)
      • engineered mutation (5)
      • engineered mutation (8)
      • engineered mutation (12)
      • engineered mutation (15)
      • engineered mutation (19)
      • engineered mutation (22)
      • engineered mutation (26)
    • Uniprot P03377 (29-78)
  • Chain 'C':
    Compound: protein (transmembrane glycoprotein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03377 (3-32)
      • conflict (0-2)

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1favA (A:)
qiedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvw
gikqlqarilaverylkdq

    Sequence, based on observed residues (ATOM records):
    >1favA (A:)
iedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvwg
ikqlqarilaverylkdq

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1favC (C:)
xexnnytslihslieesqnqqekneqelleldk

    Sequence, based on observed residues (ATOM records):
    >1favC (C:)
xexnnytslihslieesqnqqekneqellel