PDB entry 1fav

View 1fav on RCSB PDB site
Description: the structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Class: viral protein
Keywords: HIV-1, gp41, inhibitor, Viral protein
Deposited on 2000-07-13, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 envelope protein chimera
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: GCN4,AAS3,ARG9,YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (Start-28)
      • engineered (1)
      • engineered (5)
      • engineered (8)
      • engineered (12)
      • engineered (15)
      • engineered (19)
      • engineered (22)
      • engineered (26)
    • Uniprot P03377 (29-78)
    Domains in SCOPe 2.08: d1fav.1
  • Chain 'C':
    Compound: protein (transmembrane glycoprotein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03377 (3-End)
      • conflict (0-2)
    Domains in SCOPe 2.08: d1fav.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1favA (A:)
qiedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvw
gikqlqarilaverylkdq

    Sequence, based on observed residues (ATOM records): (download) 
    >1favA (A:)
iedkieeilskiyhieneiarikkligearqllsgivqqqnnllraieaqqhllqltvwg
ikqlqarilaverylkdq

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1favC (C:)
xexnnytslihslieesqnqqekneqelleldk

    Sequence, based on observed residues (ATOM records): (download) 
    >1favC (C:)
xexnnytslihslieesqnqqekneqellel