PDB entry 1fat

View 1fat on RCSB PDB site
Description: phytohemagglutinin-l
Class: lectin
Keywords: glycoprotein, plant defense protein, lectin
Deposited on 1996-06-12, released 1996-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytohemagglutinin-l
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fata_
  • Chain 'B':
    Compound: phytohemagglutinin-l
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fatb_
  • Chain 'C':
    Compound: phytohemagglutinin-l
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fatc_
  • Chain 'D':
    Compound: phytohemagglutinin-l
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fatd_
  • Heterogens: NAG, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fatA (A:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
    ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
    vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
    psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfasklsdettseg
    lnlanlvlnkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fatA (A:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlnngeprvgslgrafysapiqiwdnt
    tgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtvav
    efdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvyp
    sqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fatB (B:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
    ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
    vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
    psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfasklsdettseg
    lnlanlvlnkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fatB (B:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
    ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
    vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
    psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fatC (C:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
    ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
    vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
    psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfasklsdettseg
    lnlanlvlnkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fatC (C:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlnngeprvgslgrafysapiqiwdnt
    tgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtvav
    efdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvyp
    sqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fatD (D:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
    ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
    vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
    psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfasklsdettseg
    lnlanlvlnkil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fatD (D:)
    sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngeprvgslgrafysapiqiwdntt
    gtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtvave
    fdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvyps
    qktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls