PDB entry 1fas

View 1fas on RCSB PDB site
Description: 1.9 angstrom resolution structure of fasciculin 1, an anti-acetylcholinesterase toxin from green mamba snake venom
Class: toxin
Keywords: toxin
Deposited on 1992-08-07, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fasciculin 1
    Species: Dendroaspis angusticeps [TaxId:8618]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1fasa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fasA (A:)
    tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddylevkcctspdkcn
    y