PDB entry 1faq

View 1faq on RCSB PDB site
Description: raf-1 cysteine rich domain, nmr, 27 structures
Class: serine/threonine protein kinase
Keywords: transferase, serine/threonine-protein kinase, proto-oncogene, zinc, ATP-binding, phorbol-ester binding, serine/threonine protein kinase complex
Deposited on 1996-09-05, released 1997-01-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: raf-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1faqa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faqA (A:)
    ltthnfarktflklafcdicqkfllngfrcqtcgykfhehcstkvptmcvdw