PDB entry 1fao

View 1fao on RCSB PDB site
Description: structure of the pleckstrin homology domain from dapp1/phish in complex with inositol 1,3,4,5-tetrakisphosphate
Class: signaling protein
Keywords: pleckstrin, 3-phosphoinositides, inositol tetrakisphosphate signal transduction protein, adaptor protein, signaling protein
Deposited on 2000-07-13, released 2000-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dual adaptor of phosphotyrosine and 3-phosphoinositides
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1faoa_
  • Heterogens: 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1faoA (A:)
    mqtgrteddlvptapslgtkegyltkqgglvktwktrwftlhrnelkyfkdqmspepiri
    ldltecsavqfdysqervncfclvfpfrtfylcaktgveadewikilrwklsqirkqlnq
    gegtir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1faoA (A:)
    pslgtkegyltkqgglvktwktrwftlhrnelkyfkdqmspepirildltecsavqfdys
    qervncfclvfpfrtfylcaktgveadewikilrwklsqi