PDB entry 1fan

View 1fan on RCSB PDB site
Description: crevice-forming mutants in the rigid core of bovine pancreatic trypsin inhibitor: crystal structures of f22a, y23a, n43g, and f45a
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1992-08-21, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • conflict (44)
    Domains in SCOPe 2.06: d1fana_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fanA (A:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnaksaedcmrtcgga