PDB entry 1fan

View 1fan on RCSB PDB site
Description: crevice-forming mutants in the rigid core of bovine pancreatic trypsin inhibitor: crystal structures of f22a, y23a, n43g, and f45a
Deposited on 1992-08-21, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1fan__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fan_ (-)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnaksaedcmrtcgga