PDB entry 1fai

View 1fai on RCSB PDB site
Description:
Deposited on 1992-05-27, released 1992-10-15
The last revision prior to the SCOP 1.65 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.189
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1faih1, d1faih2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1fail1, d1fail2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faiH (H:)
    qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
    nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
    tvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpal
    lqsalytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faiL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec