PDB entry 1fai

View 1fai on RCSB PDB site
Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-05-27, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa r19.9 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1FAI (0-220)
    Domains in SCOPe 2.07: d1faih1, d1faih2, d1faih3
  • Chain 'L':
    Compound: igg2b-kappa r19.9 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fail1, d1fail2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faiH (H:)
    qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
    nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
    tvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpal
    lqsalytmsssvtvpsstwpsqtvtcsvahpassttvdkkl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1faiL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec