PDB entry 1fad

View 1fad on RCSB PDB site
Description: death domain of fas-associated death domain protein, residues 89-183
Class: apoptosis
Keywords: apoptosis, fadd, death domain
Deposited on 1999-03-23, released 1999-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fadd protein)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61160 (4-98)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d1fada_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fadA (A:)
gshmaappgeaylqvafdivcdnvgrdwkrlarelkvseakmdgieekyprslservres
lkvwknaekknasvaglvkalrtcrlnlvadlveeaqes

    Sequence, based on observed residues (ATOM records): (download) 
    >1fadA (A:)
aappgeaylqvafdivcdnvgrdwkrlarelkvseakmdgieekyprslservreslkvw
knaekknasvaglvkalrtcrlnlvadlveeaqes