PDB entry 1fa9

View 1fa9 on RCSB PDB site
Description: human liver glycogen phosphorylase a complexed with amp
Class: transferase
Keywords: protein-ligand complex, allosteric protein, phosphorylated protein, TRANSFERASE
Deposited on 2000-07-12, released 2000-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • modified residue (13)
    Domains in SCOPe 2.07: d1fa9a_
  • Heterogens: GLC, AMP, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fa9A (A:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fa9A (A:)
    tdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlv
    grwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldieelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlr
    ygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlw
    sarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatl
    qdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklpwska
    weltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdr
    lrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfqnktn
    gitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqenklk
    fsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtvi
    iggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipatdlse
    qistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaaldkk
    gyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcq
    dkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsn