PDB entry 1fa9

View 1fa9 on RCSB PDB site
Description: human liver glycogen phosphorylase a complexed with amp
Deposited on 2000-07-12, released 2000-08-25
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-25, with a file datestamp of 2000-08-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fa9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fa9A (A:)
    tdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlv
    grwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldieelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlr
    ygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlw
    sarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatl
    qdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklpwska
    weltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdr
    lrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfqnktn
    gitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqenklk
    fsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtvi
    iggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipatdlse
    qistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaaldkk
    gyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcq
    dkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsn