PDB entry 1fa4

View 1fa4 on RCSB PDB site
Description: elucidation of the paramagnetic relaxation of heteronuclei and protons in cu(ii) plastocyanin from anabaena variabilis
Deposited on 2000-07-12, released 2000-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fa4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fa4A (A:)
    etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
    hkqllmspgqststtfpadapageytfycephrgagmvgkitvag