PDB entry 1fa3

View 1fa3 on RCSB PDB site
Description: solution structure of mnei, a sweet protein
Deposited on 2000-07-12, released 2000-11-16
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fa3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fa3A (A:)
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp