PDB entry 1f9y

View 1f9y on RCSB PDB site
Description: Crystal structure of the ternary complex of E. coli HPPK with MgAMPCPP and oxidation products of 6-hydroxymethyl-7,8-dihydropterin
Deposited on 2000-07-11, released 2003-04-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-15, with a file datestamp of 2003-04-15.
Experiment type: XRAY
Resolution: 0.89 Å
R-factor: 0.112
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f9ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9yA (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw