PDB entry 1f9y

View 1f9y on RCSB PDB site
Description: Crystal structure of the ternary complex of E. coli HPPK with MgAMPCPP and oxidation products of 6-hydroxymethyl-7,8-dihydropterin
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, catalytic mechanism, folate, hppk, pterin, 6-hydroxymethyl-7,8-dihydropterin, ternary complex, substrate specificity, antimicrobial agent, 6-hydroxymethylpterin, drug design, x-ray crystallography, transferase
Deposited on 2000-07-11, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 0.89 Å
R-factor: 0.112
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
  Domains in SCOPe 2.08: d1f9ya_
• Heterogens: MG, CL, ACT, APC, HHR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f9yA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw