PDB entry 1f9x
View 1f9x on RCSB PDB site
Description: average nmr solution structure of the bir-3 domain of xiap
Class: apoptosis inhibitor
Keywords: Bir3 domain, inhibitor of apoptosis protein XIAP, Zinc finger, NMR, caspase-9 inhibition, apoptosis inhibitor
Deposited on
2000-07-11, released
2001-07-11
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: inhibitor of apoptosis protein xiap
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1f9xa_ - Heterogens: ZN
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1f9xA (A:)
gshmsdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegd
kvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Sequence, based on observed residues (ATOM records): (download)
>1f9xA (A:)
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt