PDB entry 1f9x

View 1f9x on RCSB PDB site
Description: average nmr solution structure of the bir-3 domain of xiap
Class: apoptosis inhibitor
Keywords: Bir3 domain, inhibitor of apoptosis protein XIAP, Zinc finger, NMR, caspase-9 inhibition, apoptosis inhibitor
Deposited on 2000-07-11, released 2001-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of apoptosis protein xiap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (4-119)
      • cloning artifact (3)
    Domains in SCOPe 2.08: d1f9xa1, d1f9xa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1f9xA (A:)
gshmsdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegd
kvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

    Sequence, based on observed residues (ATOM records): (download) 
    >1f9xA (A:)
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt