PDB entry 1f9t

View 1f9t on RCSB PDB site
Description: crystal structures of kinesin mutants reveal a signalling pathway for activation of the motor ATPase
Class: contractile protein
Keywords: Kar3, Kinesin-related protein, motor protein, microtubule binding protein, CONTRACTILE PROTEIN
Deposited on 2000-07-11, released 2001-06-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-like protein kar3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1f9ta_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9tA (A:)
    mrrtlhnelqelrgnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqnta
    qvhefkfdkifdqqdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgi
    ipstishifnwinklktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirh
    dqetktttitnvtsckleseemveiilkkanklrstastasnehssrshsifiihlsgsn
    aktgahsygtlnlvdlagserinvsqvvgdrlretqninkslsclgdvihalgqpdstkr
    hipfrnskltyllqysltgdsktlmfvnispssshinetlnslrfaskvnstrlvsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9tA (A:)
    gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
    qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
    klktkgwdykvncefieiynenivdllkheirhdqetktttitnvtsckleseemveiil
    kkanklrstastasnehssrshsifiihlsgsnatgahsygtlnlvdlagserretqnin
    kslsclgdvihalgqhipfrnskltyllqysltgdsktlmfvnispssshinetlnslrf
    askv