PDB entry 1f9t

View 1f9t on RCSB PDB site
Description: crystal structures of kinesin mutants reveal a signalling pathway for activation of the motor atpase
Deposited on 2000-07-11, released 2001-06-13
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-13, with a file datestamp of 2001-06-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f9ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9tA (A:)
    gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
    qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
    klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
    sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
    vdlagserinvsqvvgdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyll
    qysltgdsktlmfvnispssshinetlnslrfaskv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9tA (A:)
    gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
    qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
    klktkgwdykvncefieiynenivdllkheirhdqetktttitnvtsckleseemveiil
    kkanklrstastasnehssrshsifiihlsgsnatgahsygtlnlvdlagserretqnin
    kslsclgdvihalgqhipfrnskltyllqysltgdsktlmfvnispssshinetlnslrf
    askv