PDB entry 1f9n

View 1f9n on RCSB PDB site
Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
Class: DNA binding protein
Keywords: winged-helix-turn-helix, arginine repressor, DNA binding protein
Deposited on 2000-07-11, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9na1, d1f9na2
  • Chain 'B':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9nb1, d1f9nb2
  • Chain 'C':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9nc1, d1f9nc2
  • Chain 'D':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9nd1, d1f9nd2
  • Chain 'E':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9ne1, d1f9ne2
  • Chain 'F':
    Compound: arginine repressor/activator protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9nf1, d1f9nf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9nA (A:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9nA (A:)
    kgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyky
    slpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgti
    cgddtiliicrtpedtegvknrllell
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9nB (B:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f9nC (C:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9nC (C:)
    nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
    yslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgt
    icgddtiliicrtpedtegvknrllell
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f9nD (D:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9nD (D:)
    gqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsykys
    lpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgtic
    gddtiliicrtpedtegvknrllell
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f9nE (E:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9nE (E:)
    nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
    yslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgt
    icgddtiliicrtpedtegvknrllell
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9nF (F:)
    mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
    kyslpadqrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmg
    ticgddtiliicrtpedtegvknrllell