PDB entry 1f9k

View 1f9k on RCSB PDB site
Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose
Deposited on 2000-07-11, released 2001-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f9ka_
  • Chain 'B':
    Domains in SCOP 1.67: d1f9kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9kA (A:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9kA (A:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f9kB (B:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqetn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9kB (B:)
    etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
    sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
    avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
    hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftssl