PDB entry 1f9i

View 1f9i on RCSB PDB site
Description: crystal structure of the photoactive yellow protein mutant y42f
Class: signaling protein
Keywords: Photoreceptor, Light-Sensor for Negative Phototaxis
Deposited on 2000-07-10, released 2000-07-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.146
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Ectothiorhodospira halophila
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
    • engineered (41)
  Domains in SCOP 1.73: d1f9ia_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f9iA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqfnaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv