PDB entry 1f9h

View 1f9h on RCSB PDB site
Description: crystal structure of the ternary complex of e. coli hppk(r92a) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.50 angstrom resolution
Deposited on 2000-07-10, released 2003-04-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-15, with a file datestamp of 2003-04-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.111
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1f9ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9hA (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw