PDB entry 1f9h

View 1f9h on RCSB PDB site
Description: crystal structure of the ternary complex of e. coli hppk(r92a) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.50 angstrom resolution
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, catalytic mechanism, folate, hppk, pterin, 6-hydroxymethyl-7,8-dihydropterin, ternary complex, substrate specificity, antimicrobial agent, drug design, x-ray crystallography, transferase
Deposited on 2000-07-10, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.111
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (91)
  Domains in SCOPe 2.08: d1f9ha_
• Heterogens: MG, CL, APC, PH2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f9hA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw