PDB entry 1f9g

View 1f9g on RCSB PDB site
Description:
Deposited on 2000-07-10, released 2001-05-16
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9gA (A:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
    snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
    nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
    lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
    nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
    eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
    lsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyt
    sdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskldda
    natatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykv
    yvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdineg
    qsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyd
    akqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk
    l