PDB entry 1f9g

View 1f9g on RCSB PDB site
Description: crystal structure of streptococcus pneumoniae hyaluronate lyase cocrystallized with ascorbic acid
Class: lyase
Keywords: Ascorbic acid binds to the indole group of Trp292, TRANSMEMBRANE, SIGNAL, LYASE
Deposited on 2000-07-10, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • conflict (563)
    Domains in SCOPe 2.07: d1f9ga1, d1f9ga2, d1f9ga3
  • Heterogens: ASC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9gA (A:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    ygnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9gA (A:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
    snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
    nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
    lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
    nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
    eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
    lsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyt
    sdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskldda
    natatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykv
    yvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdineg
    qsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyd
    akqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk
    l