PDB entry 1f9f

View 1f9f on RCSB PDB site
Description: crystal structure of the hpv-18 e2 DNA-binding domain
Class: transcription
Keywords: Dimeric beta barrel, activator, DNA-binding, trans-acting factor, TRANSCRIPTION
Deposited on 2000-07-10, released 2000-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 18 [TaxId:333761]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-82)
      • cloning artifact (2-3)
    • PDB 1F9F (Start-82)
    Domains in SCOPe 2.06: d1f9fa1, d1f9fa2
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 18 [TaxId:333761]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-82)
      • cloning artifact (1-3)
    • PDB 1F9F (Start-82)
    Domains in SCOPe 2.06: d1f9fb1, d1f9fb2
  • Chain 'C':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 18 [TaxId:333761]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-82)
      • cloning artifact (1-3)
    • PDB 1F9F (Start-82)
    Domains in SCOPe 2.06: d1f9fc1, d1f9fc2
  • Chain 'D':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 18 [TaxId:333761]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06790 (4-82)
      • cloning artifact (1-3)
    • PDB 1F9F (Start-82)
    Domains in SCOPe 2.06: d1f9fd1, d1f9fd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9fA (A:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9fA (A:)
    hmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwektgiltvtyhsetqrtkflnt
    vaipdsvqilvgymtm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f9fB (B:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9fB (B:)
    shmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtktgiltvtyhsetqrtkfln
    tvaipdsvqilvgymtm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f9fC (C:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9fC (C:)
    shmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwttgiltvtyhsetqrtkflnt
    vaipdsvqilvgymtm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f9fD (D:)
    gshmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetq
    rtkflntvaipdsvqilvgymtm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9fD (D:)
    shmtpiihlkgdrnslkclryrlrkhsdhyrdisstwhwtgagnektgiltvtyhsetqr
    tkflntvaipdsvqilvgymtm