PDB entry 1f9e

View 1f9e on RCSB PDB site
Description: caspase-8 specificity probed at subsite s4: crystal structure of the caspase-8-z-devd-cho
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine protease, caspase-8, flice, mch5, mach, apoptosis, hydrolase-hydrolase inhibitor complex
Deposited on 2000-07-10, released 2001-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.241
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.1
  • Chain 'B':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.1
  • Chain 'C':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.2
  • Chain 'D':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.2
  • Chain 'E':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.3
  • Chain 'F':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.3
  • Chain 'G':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.4
  • Chain 'H':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.4
  • Chain 'I':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.5
  • Chain 'J':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.5
  • Chain 'K':
    Compound: caspase-8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC50645 (0-152)
    Domains in SCOPe 2.07: d1f9e.6
  • Chain 'L':
    Compound: caspase-8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f9e.6
  • Chain 'Q':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E
  • Chain 'R':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E
  • Chain 'S':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E
  • Chain 'T':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E
  • Chain 'U':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E
  • Chain 'V':
    Compound: (phq)devd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1F9E (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eA (A:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eB (B:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eC (C:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eD (D:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eE (E:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eF (F:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eG (G:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eH (H:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eI (I:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eJ (J:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eK (K:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f9eL (L:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfps
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.