PDB entry 1f9c

View 1f9c on RCSB PDB site
Description:
Deposited on 2000-07-10, released 2001-03-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1f9ca1, d1f9ca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1f9cb1, d1f9cb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f9cA (A:)
    tsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygy
    espegikanidahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlg
    lpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkh
    vvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqr
    tpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggt
    mlegsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglglt
    ldearlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9cA (A:)
    salieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f9cB (B:)
    tsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygy
    espegikanidahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlg
    lpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkh
    vvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqr
    tpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggt
    mlegsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglglt
    ldearlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f9cB (B:)
    salieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarfar