PDB entry 1f97

View 1f97 on RCSB PDB site
Description: soluble part of the junction adhesion molecule from mouse
Class: cell adhesion
Keywords: immunoglobulin superfamily, beta-sandwich fold, CELL ADHESION
Deposited on 2000-07-07, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.15
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: junction adhesion molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f97a1, d1f97a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f97A (A:)
    kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv
    tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvlvppskptisvpssvtign
    ravltcsehdgsppseyswfkdgismltadakktrafmnssftidpksgdlifdpvtafd
    sgeyycqaqngygtamrseaahmdavelnvgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f97A (A:)
    kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv
    tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvlvppskptisvpssvtign
    ravltcsehdgsppseyswfkdgismlttrafmnssftidpksgdlifdpvtafdsgeyy
    cqaqngygtamrseaahmdavelnvgg