PDB entry 1f96

View 1f96 on RCSB PDB site
Description: solution structure of dynein light chain 8 (dlc8) and nnos peptide complex
Class: inhibitor/oxidoreductase
Keywords: dynein, light chain, DLC8, nNOS
Deposited on 2000-07-07, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dynein light chain 8
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOP 1.75: d1f96a_
• Chain 'B':
  Compound: dynein light chain 8
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOP 1.75: d1f96b_
• Chain 'C':
  Compound: protein (nnos, neuronal nitric oxide synthase)
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: protein (nnos, neuronal nitric oxide synthase)
  Species: synthetic, synthetic
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f96A (A:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f96B (B:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.