PDB entry 1f95

View 1f95 on RCSB PDB site
Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex
Class: contractile protein/apoptosis
Keywords: dynein, light chain, DLC8, Bim
Deposited on 2000-07-07, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dynein
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOP 1.75: d1f95a_
• Chain 'B':
  Compound: dynein
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63170 (0-88)
  Domains in SCOP 1.75: d1f95b_
• Chain 'C':
  Compound: bcl2-like 11 (apoptosis facilitator)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • GB NP_006529 (0-8)
• Chain 'D':
  Compound: bcl2-like 11 (apoptosis facilitator)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • GB NP_006529 (0-8)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f95A (A:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f95B (B:)
  mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
  nfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.