PDB entry 1f95

View 1f95 on RCSB PDB site
Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex
Class: contractile protein/apoptosis
Keywords: dynein, light chain, DLC8, Bim
Deposited on 2000-07-07, released 2001-02-28
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f95a_
  • Chain 'B':
    Compound: dynein
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f95b_
  • Chain 'C':
    Compound: bcl2-like 11 (apoptosis facilitator)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_006529 (0-8)
  • Chain 'D':
    Compound: bcl2-like 11 (apoptosis facilitator)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_006529 (0-8)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f95A (A:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f95B (B:)
    mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
    nfgsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.