PDB entry 1f95
View 1f95 on RCSB PDB site
Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex
Class: contractile protein/apoptosis
Keywords: dynein, light chain, DLC8, Bim
Deposited on
2000-07-07, released
2001-02-28
The last revision prior to the SCOP 1.73 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dynein
Species: Rattus norvegicus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f95a_ - Chain 'B':
Compound: dynein
Species: Rattus norvegicus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f95b_ - Chain 'C':
Compound: bcl2-like 11 (apoptosis facilitator)
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: bcl2-like 11 (apoptosis facilitator)
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f95A (A:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f95B (B:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.